/*------------------------------------------------------------- Copyright (C) 2000 Peter Clote. All Rights Reserved. Permission to use, copy, modify, and distribute this software and its documentation for NON-COMMERCIAL purposes and without fee is hereby granted provided that this copyright notice appears in all copies. THE AUTHOR AND PUBLISHER MAKE NO REPRESENTATIONS OR WARRANTIES ABOUT THE SUITABILITY OF THE SOFTWARE, EITHER EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE IMPLIED WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE, OR NON-INFRINGEMENT. THE AUTHORS AND PUBLISHER SHALL NOT BE LIABLE FOR ANY DAMAGES SUFFERED BY LICENSEE AS A RESULT OF USING, MODIFYING OR DISTRIBUTING THIS SOFTWARE OR ITS DERIVATIVES. -------------------------------------------------------------*/ /************************************************* Program: smithWaterman.c Peter Clote, 11 Oct 2000 Program for local sequence alignment, using the Smith-Waterman algorithm and assuming a LINEAR gap penalty. A traceback is used to determine the alignment, and is determined by choosing that direction, for which S(i-1,j-1)+sigma(a_i,b_j), S(i-1,j)+Delta and S(i,j-1)+Delta is maximum, i.e. for which _ | | H(i-1,j-1) + sigma(a_i,b_j) (diagonal) H(i,j) = MAX of | H(i-1,j) + delta (up) | H(i,j-1) + delta (left) | 0 | _ is a maximum. *************************************************/ #include #include // character handling #include // def of RAND_MAX #define N 1000 // size of protein arrays #define AA 20 // number of amino acids #define MAX2(x,y) ((x)<(y) ? (y) : (x)) #define MAX3(x,y,z) (MAX2(x,y)<(z) ? (z) : MAX2(x,y)) main(int argc, char *argv[]) { // function prototypes void error(char *); /** error handling */ int char2AA(char); char AA2char(int); // variable declarations FILE * in1, *in2, *pam; char ch; int temp; int i,j,tempi,tempj,x,y,diag,down,right,DELTA; int topskip,bottomskip; char aout[N],bout[N]; int Aend,Bend,Abegin,Bbegin; int max, Max, xMax, yMax; // Max is first found maximum in similarity matrix H // max is auxilliary to determine largest of // diag,down,right, xMax,yMax are h-coord of Max short a[N], b[N]; int h[N][N]; int sim[AA][AA]; // PAM similarity matrix short xTraceback[N][N], yTraceback[N][N]; /**** Error handling for input file ****/ if (argc != 5) { fprintf(stderr,"%s protein1 protein2 PAM gapPenalty\n",argv[0]); exit(1); } /***** Initialization of input file and pair array **/ in1 = fopen(argv[1],"r"); in2 = fopen(argv[2],"r"); pam = fopen(argv[3],"r"); DELTA = atoi(argv[4]); /** read PAM250 similarity matrix **/ for (i=0;i Max){ Max=max; xMax=i; yMax=j; } } // end for loop // output values for gnuplot i=xMax; j=yMax; while ( i>0 && j>0 && h[i][j]>0){ printf("%d %d\n",i,j); //printf("%c %c\n",AA2char(a[i]),AA2char(b[j])); //printf("score %d\n",h[i][j]); // previous 2 lines for debugging tempi=i; tempj=j; i=xTraceback[tempi][tempj]; j=yTraceback[tempi][tempj]; // WARNING -- following 2 lines incorrect! // You need tempi, tempj //i=xTraceback[i][j]; //j=yTraceback[i][j]; } // initialize output arrays to be empty -- this is unnecessary for (i=0;i0 && j>0 && h[i][j] > 0){ if (topskip && bottomskip) { aout[x++]=AA2char(a[i]); bout[y++]=AA2char(b[j]); } else if (topskip) { aout[x++]='-'; bout[y++]=AA2char(b[j]); } else if (bottomskip) { aout[x++]=AA2char(a[i]); bout[y++]='-'; } topskip = (j>yTraceback[i][j]); bottomskip = (i>xTraceback[i][j]); tempi=i;tempj=j; i=xTraceback[tempi][tempj]; j=yTraceback[tempi][tempj]; // Warning -- following 2 lines no good // i=xTraceback[i][j]; // j=yTraceback[i][j]; } // print alignment printf("\n"); printf("\n"); for (i=x-1;i>=0;i--) printf("%c",aout[i]); printf("\n"); for (j=y-1;j>=0;j--) printf("%c",bout[j]); printf("\n"); printf("\n"); } void error(char * s) { fprintf(stderr,"%s\n",s); exit(1); } int char2AA(char ch){ switch (ch) { case 'C' : return 0; case 'G' : return 1; case 'P' : return 2; case 'S' : return 3; case 'A' : return 4; case 'T' : return 5; case 'D' : return 6; case 'E' : return 7; case 'N' : return 8; case 'Q' : return 9; case 'H' : return 10; case 'K' : return 11; case 'R' : return 12; case 'V' : return 13; case 'M' : return 14; case 'I' : return 15; case 'L' : return 16; case 'F' : return 17; case 'Y' : return 18; case 'W' : return 19; default : fprintf(stderr,"Nonstandard amino acid code: %d\n",ch); exit(1); } } int AA2char(int x){ switch (x) { case 0 : return 'C'; case 1 : return 'G'; case 2 : return 'P'; case 3 : return 'S'; case 4 : return 'A'; case 5 : return 'T'; case 6 : return 'D'; case 7 : return 'E'; case 8 : return 'N'; case 9 : return 'Q'; case 10: return 'H'; case 11: return 'K'; case 12: return 'R'; case 13: return 'V'; case 14: return 'M'; case 15: return 'I'; case 16: return 'L'; case 17: return 'F'; case 18: return 'Y'; case 19: return 'W'; default : fprintf(stderr,"Bad char: %d\n",x); error("Bad integer representation of AA"); } } /*--------------------------------------------------- Output of a.out Cdc25 Ste5 pam250 -10 999 821 998 820 997 819 996 818 995 817 994 816 993 815 992 814 991 813 990 812 989 811 988 810 987 809 986 808 985 807 984 806 983 805 982 804 981 803 980 802 979 801 978 800 977 799 976 798 975 797 974 796 973 795 972 794 971 793 970 792 969 791 968 790 967 789 966 788 965 787 964 786 963 785 962 784 961 783 960 782 959 781 958 780 957 779 956 778 955 777 954 776 953 775 952 774 951 773 950 772 949 771 948 770 947 769 946 768 945 767 944 766 943 765 943 764 942 763 941 762 941 761 940 760 939 759 938 758 937 757 936 756 935 755 934 754 933 753 932 752 931 751 930 750 929 749 928 748 927 747 926 746 925 745 924 744 923 743 922 742 921 741 920 740 919 739 918 738 917 737 916 736 915 735 914 734 913 733 912 732 911 731 910 730 909 729 908 728 908 727 907 726 906 725 905 724 904 723 903 722 902 721 901 720 900 719 899 718 898 717 897 716 896 715 895 714 894 713 893 712 892 711 891 710 890 709 889 708 888 707 887 706 886 705 885 704 884 703 883 702 882 701 881 700 880 699 879 698 878 697 877 696 876 695 875 694 874 693 873 692 872 691 871 690 870 689 869 688 868 687 867 686 866 685 865 684 864 683 863 682 862 681 861 680 860 679 859 678 858 677 857 676 856 675 855 674 854 673 853 672 853 671 852 670 851 669 850 668 849 667 848 666 847 665 846 664 845 663 844 662 843 661 842 660 841 659 840 658 839 657 838 656 EHLKIISKPKSRIRN-LEINSSTYEQINQNVLLLEILENLDLSIFINLKNLIKTPSILLDLESEEFLVHAM-SSVSSVLTEFFDIKQAFHDIVIRLIMTTQQTTL-DD-PYLFSSMRSNFPVGHHEPFKNISNTPLVKGPFHKKNEQLALSLFHVLVSQDVEFNNL DELVLLLPPREIAKQLCILEFQSFSHISRIQFLTKIWDNLNRFSPKEKTSTFYLSNHLVNFVTETIVQEEEPRRRTNVLAYFIQVCDYLRELNNFASLFSIISALNSSPIHRLRKTWANLNSKTLASFELLNNLTEARKNFSNYRDCLENCVLPCVPFLGVYFTDL ---------------------------------------------------*/